PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_121770_gprg.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 141aa    MW: 16210.4 Da    PI: 5.9448
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_121770_gprg.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_142.41.6e-132379561
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61
                        ++ +r+++NRe+ArrsR +K++ ++e  ++v eL+++N+ L ++ +  ++++  ++s
  Bv5_121770_gprg.t1 23 RKRKRMISNRESARRSRMKKQQHMDEMLKEVNELKSQNSGLSQKTDVVSQLYIGVES 79
                        6789**************************************999888777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.1E-131968No hitNo description
SMARTSM003385.1E-191983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.6452172IPR004827Basic-leucine zipper domain
PfamPF077161.1E-102166IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.0E-122374No hitNo description
CDDcd147029.14E-192474No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 141 aa     Download sequence    Send to blast
MQQPQQLSSG SDSDPKYANM DERKRKRMIS NRESARRSRM KKQQHMDEML KEVNELKSQN  60
SGLSQKTDVV SQLYIGVESE NNVLRAQVIE LTDRLRSLNS VLQFMQDASG FAMDIPEIPD  120
NLLEPWQLPC PVQAIPNVFQ C
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010679380.11e-101PREDICTED: ocs element-binding factor 1
SwissprotQ9LZP82e-52BZP53_ARATH; bZIP transcription factor 53
TrEMBLA0A0J8F2R21e-101A0A0J8F2R2_BETVU; Uncharacterized protein
STRINGPOPTR_0002s19720.14e-56(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.11e-53basic region/leucine zipper motif 53